PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00031.1.g00520.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 1077aa    MW: 116986 Da    PI: 7.7737
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00031.1.g00520.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.39.7e-924697972374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                    +lLl+cAe v++++l  a+++L ++ ela+p g+++qR+aa  + +L a l              + +         a +
  Zjn_sc00031.1.g00520.1.am.mk 469 LTLLLQCAESVNADNLDDAHQTLLEIAELATPFGTSTQRVAASCL-GLYAPLPA-----------ASPA---------AAR 528
                                   579**************************************9765.45554444...........3333.........334 PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetge 163
                                   l s v   ++fsh+taNqaI ea+e+e+r          GlQWp L++ LasRp+gpp++++Tg+g+    s e le+tg+
  Zjn_sc00031.1.g00520.1.am.mk 529 LNSRVAAAFQFSHFTANQAIQEAFEREDR----------GLQWPGLFHILASRPGGPPRVKLTGLGA----SMEVLEATGK 595
                                   445566689******************86..........****************************....********** PP

                          GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                                   rL++fA +lg+pfef + va++  ++++e+L v ++Ea+aV++ +  h+l+d ++s ++    +L+l+++l Pkvv++veq
  Zjn_sc00031.1.g00520.1.am.mk 596 RLSDFALTLGLPFEFCA-VAEKAGNVDPEKLGVTRREAVAVHWLH--HSLYDVTGSDSN----TLWLIQRLAPKVVTMVEQ 669
                                   *****************.7*************************9..999999999999....****************** PP

                          GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFk 325
                                   +++h s+sFl+rf+ea++yysalfdsl+a+++++s er++vE++ll+rei+nv+a  g +r  + + +++Wre+l ++GF+
  Zjn_sc00031.1.g00520.1.am.mk 670 DLSH-SGSFLARFVEAIHYYSALFDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARSGDVK-FGSWREKLAQSGFR 748
                                   ****.899****************************************************988887.************** PP

                          GRAS 326 pvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   +++l  +aa+qa+lll +++sdgy++ ee+g+l lgWkd  L+++SaWr
  Zjn_sc00031.1.g00520.1.am.mk 749 AASLAGSAAAQASLLLGMFPSDGYTLVEENGALKLGWKDLCLLTASAWR 797
                                   ************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.921442777IPR005202Transcription factor GRAS
PfamPF035143.4E-89469797IPR005202Transcription factor GRAS
PfamPF046784.1E-509081066IPR006769Coiled-coil domain containing protein 109, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 1077 aa     Download sequence    Send to blast
MGVSTKRAAT GEKCDGCTGL HGGVRVAKKA RPFCELGERE RGHTCTSRHH RKAGVPIHDA  60
SSQGLFLFLL LQPCSLESEA TPHSSVVNGS DRMVRPSLLH GQLRPNLSSK KHERGHKLGS  120
PNLLCLRCWS PARGVFHFTH RPPLTLTHHS LVYSTTTITT TPQRAACSPW RLQMGSSSLL  180
LFPSSSSAAS ASPSYSSHGT PATTSASQYS LLPPLPETSS SSSAQQDHQL LLHYLHLDDH  240
HQQQLAMVRK RPAPADMDLP PPPRRHVTGD LSDVTAAAGA PQPPSSASAQ LPALPTQLQL  300
PAFGQQHAGE VDVAPAQVVQ QPGDVTTAST AALVDGIIRD IIGSSGAAVS VTQLIQNVRE  360
IIQPCNPGLA SLLELRLRSL LAADPAALPP PPHQHPALIH HHHHTAPPTA AAPGCQEEPN  420
PAPQSPKPPT AEETAAAAAA AAAAAAAAAK ERKEEQLRKQ RDEEGLHLLT LLLQCAESVN  480
ADNLDDAHQT LLEIAELATP FGTSTQRVAA SCLGLYAPLP AASPAAARLN SRVAAAFQFS  540
HFTANQAIQE AFEREDRGLQ WPGLFHILAS RPGGPPRVKL TGLGASMEVL EATGKRLSDF  600
ALTLGLPFEF CAVAEKAGNV DPEKLGVTRR EAVAVHWLHH SLYDVTGSDS NTLWLIQRLA  660
PKVVTMVEQD LSHSGSFLAR FVEAIHYYSA LFDSLDASYG EDSPERHVVE QQLLSREIRN  720
VLAVGGPARS GDVKFGSWRE KLAQSGFRAA SLAGSAAAQA SLLLGMFPSD GYTLVEENGA  780
LKLGWKDLCL LTASAWRPIQ PAGRTTTMWR AAASRLLRHR PASTSAAATA LLLHARLFSP  840
PAPSPRWRPA QAEASELEVT PPEARRLLRL VGVEALKRRL RDGPDEVLGY AELLDACVEA  900
GAARTLAEAE ALARALDDAG VVLLFRDKAY LHPEKVVDLV RRAMPLTLEP EKNDPRKEEF  960
KQLQERKEEI DKLAHKQVRR ILWSGLGFFM CQVGLFFRLT FWEFSWDVME PVAFFTTASG  1020
LLVGYAYFLI TSRDPTYQDF MERLFSSRQR KLCAMHKFDM ERYLELQKQC KCPLEGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3353879791375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0636820.0BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620600.10.0PREDICTED: protein SCARECROW 2
SwissprotA2ZHL00.0SCR2_ORYSI; Protein SCARECROW 2
SwissprotQ2QYF30.0SCR2_ORYSJ; Protein SCARECROW 2
TrEMBLA0A0E0RD240.0A0A0E0RD24_ORYRU; Uncharacterized protein
STRINGLOC_Os12g02870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-158GRAS family protein